PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ES4A3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 189aa    MW: 21231.4 Da    PI: 7.6728
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ES4A3genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-323893156
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                 k+r++W+peLH+rF++a++qLGG+++AtPk+i+elm+v++Lt+++vkSHLQkYRl+
  Aradu.ES4A3 38 KQRRCWSPELHRRFINALQQLGGAQVATPKQIRELMQVESLTNDEVKSHLQKYRLH 93
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1773595IPR017930Myb domain
SuperFamilySSF466891.2E-183696IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-293696IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-273893IPR006447Myb domain, plants
PfamPF002498.7E-84091IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MTTTPAPELK SSSSKSNSSS LFMNRVEIQA QQSQNPRKQR RCWSPELHRR FINALQQLGG  60
AQVATPKQIR ELMQVESLTN DEVKSHLQKY RLHVRKFPVS SSAEHDANNN NIDDDDEDDL  120
WEMKKKDQCG KGNKNSSSQS QSGSPQGPLL LAGSVKGLSS MDADDEHSDC RNWKAAIHHQ  180
PPESDNHSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963952.11e-137PREDICTED: uncharacterized protein LOC107487772 isoform X1
RefseqXP_015963953.11e-137PREDICTED: uncharacterized protein LOC107487772 isoform X2
TrEMBLA0A151THY43e-60A0A151THY4_CAJCA; Two-component response regulator ARR1
STRINGGLYMA01G39040.12e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.12e-33G2-like family protein